SCOP 1.73: Domain d4cpab_: 4cpa B:

Lineage for d4cpab_ (4cpa B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries)

8. Domain d4cpab_: 4cpa B: [118682]
   Other proteins in same PDB: d4cpai_, d4cpaj_
   duplicate of 4CPA
   complexed with zn

Details for d4cpab_

PDB Entry: 4cpa, 2.5 Å

PDB Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution

PDB Compounds: (B:) carboxypeptidase a

SCOP Domain Sequences for d4cpab_:

Sequence; same for both SEQRES and ATOM records:

>d4cpab_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d4cpab_:

• d4cpab_ is new in SCOP 1.73
  
• d4cpab_ appears in SCOP 1.75
  
• d4cpab_ appears in the current release, SCOPe 2.08