Lineage for d4cpab_ (4cpa B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. Protein Carboxypeptidase A [53189] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. Domain d4cpab_: 4cpa B: [118682]
    Other proteins in same PDB: d4cpai_, d4cpaj_
    duplicate of 4CPA
    complexed with gly, zn

Details for d4cpab_

PDB Entry: 4cpa (more details), 2.5 Å

PDB Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution
PDB Compounds: (B:) carboxypeptidase a

SCOPe Domain Sequences for d4cpab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpab_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOPe Domain Coordinates for d4cpab_ are not available.

Timeline for d4cpab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cpaa_, d4cpai_, d4cpaj_