Lineage for d3sody_ (3sod Y:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658090Species Cow (Bos taurus) [TaxId:9913] [49332] (17 PDB entries)
  8. 658122Domain d3sody_: 3sod Y: [118681]
    complexed with cu, zn; mutant

Details for d3sody_

PDB Entry: 3sod (more details), 2.1 Å

PDB Description: changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine
PDB Compounds: (Y:) Copper,Zinc Superoxide Dismutase

SCOP Domain Sequences for d3sody_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sody_ b.1.8.1 (Y:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d3sody_:

Click to download the PDB-style file with coordinates for d3sody_.
(The format of our PDB-style files is described here.)

Timeline for d3sody_: