SCOP 1.75: Domain d3sodb_: 3sod B:

Lineage for d3sodb_ (3sod B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (21 PDB entries)

8. Domain d3sodb_: 3sod B: [118679]

Details for d3sodb_

PDB Entry: 3sod, 2.1 Å

PDB Description: changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine

PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOP Domain Sequences for d3sodb_:

Sequence; same for both SEQRES and ATOM records:

>d3sodb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d3sodb_:

• d3sodb_ first appeared in SCOP 1.73
  
• d3sodb_ appears in SCOPe 2.01
  
• d3sodb_ appears in the current release, SCOPe 2.08