Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries) Uniprot P68871 |
Domain d3hhbd_: 3hhb D: [118677] Other proteins in same PDB: d3hhba_, d3hhbc_ duplicate of 3HHB B complexed with hem, po4 |
PDB Entry: 3hhb (more details), 1.74 Å
SCOPe Domain Sequences for d3hhbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhbd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d3hhbd_: