Lineage for d2taac2 (2taa C:1-381)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438812Protein Fungal alpha-amylases [51462] (2 species)
  7. 2438815Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (8 PDB entries)
  8. 2438826Domain d2taac2: 2taa C:1-381 [118675]
    Other proteins in same PDB: d2taaa1, d2taab1, d2taac1
    duplicate of 2TAA A:1-381
    complexed with ca

Details for d2taac2

PDB Entry: 2taa (more details), 3 Å

PDB Description: structure and possible catalytic residues of taka-amylase a
PDB Compounds: (C:) taka-amylase a

SCOPe Domain Sequences for d2taac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2taac2 c.1.8.1 (C:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqdcaygdaytgywqtdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndglpiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOPe Domain Coordinates for d2taac2:

Click to download the PDB-style file with coordinates for d2taac2.
(The format of our PDB-style files is described here.)

Timeline for d2taac2: