Lineage for d2sbla1 (2sbl A:150-839)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008083Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 2008084Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (17 PDB entries)
  8. 2008100Domain d2sbla1: 2sbl A:150-839 [118670]
    Other proteins in same PDB: d2sbla2, d2sblb2
    duplicate of 2SBL B:150-839
    complexed with fe

Details for d2sbla1

PDB Entry: 2sbl (more details), 2.6 Å

PDB Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase
PDB Compounds: (A:) lipoxygenase-1

SCOPe Domain Sequences for d2sbla1:

Sequence, based on SEQRES records: (download)

>d2sbla1 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

Sequence, based on observed residues (ATOM records): (download)

>d2sbla1 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfviathr
hlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyknwvf
tdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyyard
ddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaavnfg
qypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvieilst
hasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpvqlp
ytllypsseegltfrgipnsisi

SCOPe Domain Coordinates for d2sbla1:

Click to download the PDB-style file with coordinates for d2sbla1.
(The format of our PDB-style files is described here.)

Timeline for d2sbla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sbla2