Lineage for d2lgsf1 (2lgs F:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718125Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 718126Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 718127Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 718183Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 718225Domain d2lgsf1: 2lgs F:1-100 [118656]
    Other proteins in same PDB: d2lgsa2, d2lgsb2, d2lgsc2, d2lgsd2, d2lgse2, d2lgsf2, d2lgsg2, d2lgsh2, d2lgsi2, d2lgsj2, d2lgsk2, d2lgsl2

Details for d2lgsf1

PDB Entry: 2lgs (more details), 2.8 Å

PDB Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine
PDB Compounds: (F:) glutamine synthetase

SCOP Domain Sequences for d2lgsf1:

Sequence, based on SEQRES records: (download)

>d2lgsf1 d.15.9.1 (F:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d2lgsf1 d.15.9.1 (F:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d2lgsf1:

Click to download the PDB-style file with coordinates for d2lgsf1.
(The format of our PDB-style files is described here.)

Timeline for d2lgsf1: