SCOP 1.73: Domain d2ldxc2: 2ldx C:160-331

Lineage for d2ldxc2 (2ldx C:160-331)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (15 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry)

8. Domain d2ldxc2: 2ldx C:160-331 [118645]
   Other proteins in same PDB: d2ldxa1, d2ldxb1, d2ldxc1, d2ldxd1
   duplicate of 2LDX 160-331

Details for d2ldxc2

PDB Entry: 2ldx, 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4

PDB Compounds: (C:) apo-lactate dehydrogenase

SCOP Domain Sequences for d2ldxc2:

Sequence; same for both SEQRES and ATOM records:

>d2ldxc2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel

Timeline for d2ldxc2:

• d2ldxc2 is new in SCOP 1.73
  
• d2ldxc2 appears in SCOP 1.75
  
• d2ldxc2 appears in the current release, SCOPe 2.08