SCOPe 2.08: Domain d2ldxb2: 2ldx B:160-331

Lineage for d2ldxb2 (2ldx B:160-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry)

8. Domain d2ldxb2: 2ldx B:160-331 [118643]
   Other proteins in same PDB: d2ldxa1, d2ldxb1, d2ldxc1, d2ldxd1
   duplicate of 2LDX 160-331

Details for d2ldxb2

PDB Entry: 2ldx, 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4

PDB Compounds: (B:) apo-lactate dehydrogenase

SCOPe Domain Sequences for d2ldxb2:

Sequence; same for both SEQRES and ATOM records:

>d2ldxb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel

Timeline for d2ldxb2:

• d2ldxb2 first appeared in SCOP 1.73
  
• d2ldxb2 appears in SCOPe 2.07