Lineage for d2ldbd2 (2ldb D:163-331)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737038Protein Lactate dehydrogenase [56339] (15 species)
  7. 737042Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 737058Domain d2ldbd2: 2ldb D:163-331 [118641]
    Other proteins in same PDB: d2ldba1, d2ldbb1, d2ldbc1, d2ldbd1
    duplicate of 2LDB 163-331
    complexed with fbp, nad, so4

Details for d2ldbd2

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (D:) l-lactate dehydrogenase

SCOP Domain Sequences for d2ldbd2:

Sequence, based on SEQRES records: (download)

>d2ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d2ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler
ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig
vpavinrngirevieielnddeknrfhhsaatlksvlaraftr

SCOP Domain Coordinates for d2ldbd2:

Click to download the PDB-style file with coordinates for d2ldbd2.
(The format of our PDB-style files is described here.)

Timeline for d2ldbd2: