Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (20 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
Domain d2ldbd2: 2ldb D:163-331 [118641] Other proteins in same PDB: d2ldba1, d2ldbb1, d2ldbc1, d2ldbd1 duplicate of 2LDB 163-331 complexed with fbp, nad, so4 |
PDB Entry: 2ldb (more details), 3 Å
SCOPe Domain Sequences for d2ldbd2:
Sequence, based on SEQRES records: (download)
>d2ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
>d2ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig vpavinrngirevieielnddeknrfhhsaatlksvlaraftr
Timeline for d2ldbd2: