Lineage for d2ldbd1 (2ldb D:15-162)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 687941Protein Lactate dehydrogenase [51859] (14 species)
  7. 687942Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 687958Domain d2ldbd1: 2ldb D:15-162 [118640]
    Other proteins in same PDB: d2ldba2, d2ldbb2, d2ldbc2, d2ldbd2
    duplicate of 2LDB 15-162
    complexed with fbp, nad, so4

Details for d2ldbd1

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (D:) l-lactate dehydrogenase

SCOP Domain Sequences for d2ldbd1:

Sequence, based on SEQRES records: (download)

>d2ldbd1 c.2.1.5 (D:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records): (download)

>d2ldbd1 c.2.1.5 (D:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

SCOP Domain Coordinates for d2ldbd1:

Click to download the PDB-style file with coordinates for d2ldbd1.
(The format of our PDB-style files is described here.)

Timeline for d2ldbd1: