SCOP 1.73: Domain d2ldbc2: 2ldb C:163-331

Lineage for d2ldbc2 (2ldb C:163-331)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (15 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d2ldbc2: 2ldb C:163-331 [118639]
   Other proteins in same PDB: d2ldba1, d2ldbb1, d2ldbc1, d2ldbd1
   duplicate of 2LDB 163-331
   complexed with fbp, nad, so4

Details for d2ldbc2

PDB Entry: 2ldb, 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

PDB Compounds: (C:) l-lactate dehydrogenase

SCOP Domain Sequences for d2ldbc2:

Sequence, based on SEQRES records:

>d2ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records):

>d2ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler
ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig
vpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Timeline for d2ldbc2:

• d2ldbc2 is new in SCOP 1.73
  
• d2ldbc2 appears in SCOP 1.75
  
• d2ldbc2 appears in the current release, SCOPe 2.08