![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
![]() | Protein Lactate dehydrogenase [56339] (15 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
![]() | Domain d2ldbc2: 2ldb C:163-331 [118639] Other proteins in same PDB: d2ldba1, d2ldbb1, d2ldbc1, d2ldbd1 duplicate of 2LDB 163-331 complexed with fbp, nad, so4 |
PDB Entry: 2ldb (more details), 3 Å
SCOP Domain Sequences for d2ldbc2:
Sequence, based on SEQRES records: (download)
>d2ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
>d2ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig vpavinrngirevieielnddeknrfhhsaatlksvlaraftr
Timeline for d2ldbc2: