SCOPe 2.07: Domain d2ldbc1: 2ldb C:15-162

Lineage for d2ldbc1 (2ldb C:15-162)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)

8. Domain d2ldbc1: 2ldb C:15-162 [118638]
   Other proteins in same PDB: d2ldba2, d2ldbb2, d2ldbc2, d2ldbd2
   duplicate of 2LDB 15-162
   complexed with fbp, nad, so4

Details for d2ldbc1

PDB Entry: 2ldb, 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ldbc1:

Sequence, based on SEQRES records:

>d2ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records):

>d2ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

Timeline for d2ldbc1:

• d2ldbc1 first appeared in SCOP 1.73
  
• d2ldbc1 appears in SCOPe 2.06
  
• d2ldbc1 appears in the current release, SCOPe 2.08