Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (14 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries) |
Domain d2ldbc1: 2ldb C:15-162 [118638] Other proteins in same PDB: d2ldba2, d2ldbb2, d2ldbc2, d2ldbd2 duplicate of 2LDB 15-162 complexed with fbp, nad, so4 |
PDB Entry: 2ldb (more details), 3 Å
SCOPe Domain Sequences for d2ldbc1:
Sequence, based on SEQRES records: (download)
>d2ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl vatnpvdiltyatwkfsglphervigsg
>d2ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt yatwkfsglphervigsg
Timeline for d2ldbc1: