Lineage for d2ldbb1 (2ldb B:15-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844355Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 2844365Domain d2ldbb1: 2ldb B:15-162 [118636]
    Other proteins in same PDB: d2ldba2, d2ldbb2, d2ldbc2, d2ldbd2
    duplicate of 2LDB 15-162
    complexed with fbp, nad, so4

Details for d2ldbb1

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ldbb1:

Sequence, based on SEQRES records: (download)

>d2ldbb1 c.2.1.5 (B:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records): (download)

>d2ldbb1 c.2.1.5 (B:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

SCOPe Domain Coordinates for d2ldbb1:

Click to download the PDB-style file with coordinates for d2ldbb1.
(The format of our PDB-style files is described here.)

Timeline for d2ldbb1: