SCOPe 2.08: Domain d2cha.2: 2cha E:,F:,G:

Lineage for d2cha.2 (2cha E:,F:,G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d2cha.2: 2cha E:,F:,G: [118635]
   complexed with tsu

Details for d2cha.2

PDB Entry: 2cha, 2 Å

PDB Description: the structure of crystalline alpha-chymotrypsin, $v.the atomic structure of tosyl-alpha-chymotrypsin at 2 angstroms resolution

PDB Compounds: (E:) alpha-chymotrypsin a, (F:) alpha-chymotrypsin a, (G:) alpha-chymotrypsin a

SCOPe Domain Sequences for d2cha.2:

Sequence; same for both SEQRES and ATOM records:

>g2cha.2 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
asddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d2cha.2:

• d2cha.2 first appeared in SCOP 1.73
  
• d2cha.2 appears in SCOPe 2.07