Lineage for d2bpra1 (2bpr A:382-506)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824543Protein DnaK [100922] (3 species)
  7. 2824547Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 2824554Domain d2bpra1: 2bpr A:382-506 [118634]
    Other proteins in same PDB: d2bpra2
    trimmed to exclude a fragment of another domain, used as a covalent linker to the bound peptide

Details for d2bpra1

PDB Entry: 2bpr (more details)

PDB Description: nmr structure of the substrate binding domain of dnak, 25 structures
PDB Compounds: (A:) dnak

SCOPe Domain Sequences for d2bpra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpra1 b.130.1.1 (A:382-506) DnaK {Escherichia coli [TaxId: 562]}
iegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvl
qgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkiti
kassg

SCOPe Domain Coordinates for d2bpra1:

Click to download the PDB-style file with coordinates for d2bpra1.
(The format of our PDB-style files is described here.)

Timeline for d2bpra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bpra2