Lineage for d1xysb_ (1xys B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094224Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2094250Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
    Uniprot P14768 265-610
  8. 2094264Domain d1xysb_: 1xys B: [118633]
    duplicate of 1XYS
    complexed with ca; mutant

Details for d1xysb_

PDB Entry: 1xys (more details), 2.5 Å

PDB Description: catalytic core of xylanase a e246c mutant
PDB Compounds: (B:) xylanase a

SCOPe Domain Sequences for d1xysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xysb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOPe Domain Coordinates for d1xysb_:

Click to download the PDB-style file with coordinates for d1xysb_.
(The format of our PDB-style files is described here.)

Timeline for d1xysb_: