![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Dihydrodipicolinate reductase [51821] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110417] (1 PDB entry) Uniprot Q9X1K8 |
![]() | Domain d1vm6c3: 1vm6 C:1-96,C:183-214 [118632] Other proteins in same PDB: d1vm6a2, d1vm6a4, d1vm6b2, d1vm6b3, d1vm6c2, d1vm6d2, d1vm6d3 Structural genomics target complexed with act, edo, nad, pg4 |
PDB Entry: 1vm6 (more details), 2.27 Å
SCOPe Domain Sequences for d1vm6c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vm6c3 c.2.1.3 (C:1-96,C:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} mkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealpktvdl ckkyraglvlgttalkeehlqmlrelskevpvvqayXsrtvfaigalkaaeflvgkdpgm ysfeevifg
Timeline for d1vm6c3: