Lineage for d1vm6c3 (1vm6 C:1-96,C:183-214)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843684Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 2843711Species Thermotoga maritima [TaxId:2336] [110417] (1 PDB entry)
    Uniprot Q9X1K8
  8. 2843714Domain d1vm6c3: 1vm6 C:1-96,C:183-214 [118632]
    Other proteins in same PDB: d1vm6a2, d1vm6a4, d1vm6b2, d1vm6b3, d1vm6c2, d1vm6d2, d1vm6d3
    Structural genomics target
    complexed with act, edo, nad, pg4

Details for d1vm6c3

PDB Entry: 1vm6 (more details), 2.27 Å

PDB Description: crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
PDB Compounds: (C:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1vm6c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vm6c3 c.2.1.3 (C:1-96,C:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]}
mkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealpktvdl
ckkyraglvlgttalkeehlqmlrelskevpvvqayXsrtvfaigalkaaeflvgkdpgm
ysfeevifg

SCOPe Domain Coordinates for d1vm6c3:

Click to download the PDB-style file with coordinates for d1vm6c3.
(The format of our PDB-style files is described here.)

Timeline for d1vm6c3: