Lineage for d1vfta3 (1vft A:4-12,A:250-385)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671787Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 671788Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 671789Protein Alanine racemase [50623] (3 species)
  7. 671809Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)
  8. 671813Domain d1vfta3: 1vft A:4-12,A:250-385 [118630]
    Other proteins in same PDB: d1vfta2, d1vftb2

Details for d1vfta3

PDB Entry: 1vft (more details), 2.3 Å

PDB Description: Crystal structure of L-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae
PDB Compounds: (A:) alanine racemase

SCOP Domain Sequences for d1vfta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfta3 b.49.2.2 (A:4-12,A:250-385) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
tptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasg
rgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahti
ayeivtriggrvprvylgglehhhhh

SCOP Domain Coordinates for d1vfta3:

Click to download the PDB-style file with coordinates for d1vfta3.
(The format of our PDB-style files is described here.)

Timeline for d1vfta3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vfta2