Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
Protein Alanine racemase [50623] (3 species) |
Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries) Uniprot Q65YW7 |
Domain d1vfta3: 1vft A:4-12,A:250-378 [118630] Other proteins in same PDB: d1vfta2, d1vfta4, d1vftb2, d1vftb3 complexed with cl, dcs |
PDB Entry: 1vft (more details), 2.3 Å
SCOPe Domain Sequences for d1vfta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfta3 b.49.2.2 (A:4-12,A:250-378) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} tptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasg rgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahti ayeivtriggrvprvylgg
Timeline for d1vfta3: