Lineage for d1smre_ (1smr E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060793Species Mouse (Mus musculus) [TaxId:10090] [50670] (1 PDB entry)
  8. 2060796Domain d1smre_: 1smr E: [118628]
    duplicate of 1SMR A

Details for d1smre_

PDB Entry: 1smr (more details), 2 Å

PDB Description: the 3-d structure of mouse submaxillary renin complexed with a decapeptide inhibitor ch-66 based on the 4-16 fragment of rat angiotensinogen
PDB Compounds: (E:) renin

SCOPe Domain Sequences for d1smre_:

Sequence, based on SEQRES records: (download)

>d1smre_ b.50.1.2 (E:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]}
tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
ppptgpvwvlgatfirkfytefdrhnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d1smre_ b.50.1.2 (E:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]}
tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
gpvwvlgatfirkfytefdrhnnrigfalar

SCOPe Domain Coordinates for d1smre_:

Click to download the PDB-style file with coordinates for d1smre_.
(The format of our PDB-style files is described here.)

Timeline for d1smre_: