Lineage for d1rscb1 (1rsc B:148-475)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818439Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 818440Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 818441Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 818632Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [51656] (2 PDB entries)
  8. 818642Domain d1rscb1: 1rsc B:148-475 [118606]
    Other proteins in same PDB: d1rsca2, d1rscb2, d1rscc2, d1rscd2, d1rsce2, d1rscf2, d1rscg2, d1rsch2, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_
    duplicate of 1RSC A:148-475
    complexed with xbp

Details for d1rscb1

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (B:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOP Domain Sequences for d1rscb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rscb1 c.1.14.1 (B:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkeikfefetmdkl

SCOP Domain Coordinates for d1rscb1:

Click to download the PDB-style file with coordinates for d1rscb1.
(The format of our PDB-style files is described here.)

Timeline for d1rscb1: