| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
| Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries) |
| Domain d1rbln_: 1rbl N: [118603] Other proteins in same PDB: d1rbla1, d1rbla2, d1rblb1, d1rblb2, d1rblc1, d1rblc2, d1rbld1, d1rbld2, d1rble1, d1rble2, d1rblf1, d1rblf2, d1rblg1, d1rblg2, d1rblh1, d1rblh2 duplicate of 1RBL M complexed with cap, cbx, mg |
PDB Entry: 1rbl (more details), 2.2 Å
SCOP Domain Sequences for d1rbln_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbln_ d.73.1.1 (N:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
Timeline for d1rbln_: