SCOPe 2.01: Domain d1rbll_: 1rbl L:

Lineage for d1rbll_ (1rbl L:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)

8. Domain d1rbll_: 1rbl L: [118602]
   Other proteins in same PDB: d1rbla1, d1rbla2, d1rblb1, d1rblb2, d1rblc1, d1rblc2, d1rbld1, d1rbld2, d1rble1, d1rble2, d1rblf1, d1rblf2, d1rblg1, d1rblg2, d1rblh1, d1rblh2
   duplicate of 1RBL M
   complexed with cap, fmt, mg

Details for d1rbll_

PDB Entry: 1rbl, 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

PDB Compounds: (L:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rbll_:

Sequence; same for both SEQRES and ATOM records:

>d1rbll_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr

Timeline for d1rbll_:

• d1rbll_ first appeared in SCOP 1.73
  
• d1rbll_ appears in SCOP 1.75
  
• d1rbll_ appears in SCOPe 2.02
  
• d1rbll_ appears in the current release, SCOPe 2.08