Lineage for d1rblh2 (1rbl H:9-147)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559643Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2559644Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2559820Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 2559828Domain d1rblh2: 1rbl H:9-147 [118598]
    Other proteins in same PDB: d1rbla1, d1rblb1, d1rblc1, d1rbld1, d1rble1, d1rblf1, d1rblg1, d1rblh1, d1rbli_, d1rblj_, d1rblk_, d1rbll_, d1rblm_, d1rbln_, d1rblo_, d1rblp_
    duplicate of 1RBL A:9-147
    complexed with cap, fmt, mg

Details for d1rblh2

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301
PDB Compounds: (H:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rblh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rblh2 d.58.9.1 (H:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOPe Domain Coordinates for d1rblh2:

Click to download the PDB-style file with coordinates for d1rblh2.
(The format of our PDB-style files is described here.)

Timeline for d1rblh2: