Lineage for d1rblg1 (1rbl G:148-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838687Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [51656] (2 PDB entries)
  8. 2838694Domain d1rblg1: 1rbl G:148-475 [118595]
    Other proteins in same PDB: d1rbla2, d1rblb2, d1rblc2, d1rbld2, d1rble2, d1rblf2, d1rblg2, d1rblh2, d1rbli_, d1rblj_, d1rblk_, d1rbll_, d1rblm_, d1rbln_, d1rblo_, d1rblp_
    duplicate of 1RBL A:148-475
    complexed with cap, fmt, mg

Details for d1rblg1

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301
PDB Compounds: (G:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rblg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rblg1 c.1.14.1 (G:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkeikfefetmdkl

SCOPe Domain Coordinates for d1rblg1:

Click to download the PDB-style file with coordinates for d1rblg1.
(The format of our PDB-style files is described here.)

Timeline for d1rblg1: