Lineage for d1rblb2 (1rbl B:9-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724905Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 724907Domain d1rblb2: 1rbl B:9-147 [118586]
    Other proteins in same PDB: d1rbla1, d1rblb1, d1rblc1, d1rbld1, d1rble1, d1rblf1, d1rblg1, d1rblh1, d1rbli_, d1rblj_, d1rblk_, d1rbll_, d1rblm_, d1rbln_, d1rblo_, d1rblp_
    duplicate of 1RBL A:9-147
    complexed with cap, cbx, mg

Details for d1rblb2

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301
PDB Compounds: (B:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOP Domain Sequences for d1rblb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rblb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOP Domain Coordinates for d1rblb2:

Click to download the PDB-style file with coordinates for d1rblb2.
(The format of our PDB-style files is described here.)

Timeline for d1rblb2: