Lineage for d1pypb_ (1pyp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790737Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)
  8. 2790775Domain d1pypb_: 1pyp B: [118584]
    duplicate of 1PYP
    has additional insertions and/or extensions that are not grouped together

Details for d1pypb_

PDB Entry: 1pyp (more details), 3 Å

PDB Description: x-ray diffraction study of inorganic pyrophosphatase from baker,s yeast at the 3 angstroms resolution (russian)
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1pypb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pypb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
ltnvtlpdtptyskaasdaippaspkadapidksidkwffi

SCOPe Domain Coordinates for d1pypb_:

Click to download the PDB-style file with coordinates for d1pypb_.
(The format of our PDB-style files is described here.)

Timeline for d1pypb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pypa_