Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Glutaconyl-CoA decarboxylase A subunit [102210] (1 species) |
Species Acidaminococcus fermentans [TaxId:905] [102211] (1 PDB entry) |
Domain d1pixb3: 1pix B:288-586 [118581] complexed with fmt, so4 |
PDB Entry: 1pix (more details), 2.2 Å
SCOP Domain Sequences for d1pixb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pixb3 c.14.1.4 (B:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} ydpeffrvddpkapafpaddlysmvplndkraydiynviarlfdnselheykkgygpemv tglakvngllvgvvanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlp ivwiqdttgidvgndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqg ndtnafsigtaateiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytks rpkvcaelglvdeivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk
Timeline for d1pixb3: