Lineage for d1pixb3 (1pix B:288-586)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. Protein Glutaconyl-CoA decarboxylase A subunit, C-terminal domain [418959] (2 species)
  7. Species Acidaminococcus fermentans [TaxId:905] [419419] (1 PDB entry)
  8. Domain d1pixb3: 1pix B:288-586 [118581]
    Other proteins in same PDB: d1pixa2, d1pixb2
    complexed with fmt, so4

Details for d1pixb3

PDB Entry: 1pix (more details), 2.2 Å

PDB Description: Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme A decarboxylase
PDB Compounds: (B:) Glutaconyl-CoA decarboxylase A subunit

SCOPe Domain Sequences for d1pixb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pixb3 c.14.1.4 (B:288-586) Glutaconyl-CoA decarboxylase A subunit, C-terminal domain {Acidaminococcus fermentans [TaxId: 905]}
ydpeffrvddpkapafpaddlysmvplndkraydiynviarlfdnselheykkgygpemv
tglakvngllvgvvanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlp
ivwiqdttgidvgndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqg
ndtnafsigtaateiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytks
rpkvcaelglvdeivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk

SCOPe Domain Coordinates for d1pixb3 are not available.

Timeline for d1pixb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pixb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pixa2, d1pixa3