SCOPe 2.08: Domain d1pixb2: 1pix B:1-287

Lineage for d1pixb2 (1pix B:1-287)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Glutaconyl-CoA decarboxylase A subunit, N-terminal domain [418958] (2 species)

7. Species Acidaminococcus fermentans [TaxId:905] [419418] (1 PDB entry)

8. Domain d1pixb2: 1pix B:1-287 [118580]
   Other proteins in same PDB: d1pixa3, d1pixb3
   complexed with fmt, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1pixb2

PDB Entry: 1pix, 2.2 Å

PDB Description: Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme A decarboxylase

PDB Compounds: (B:) Glutaconyl-CoA decarboxylase A subunit

SCOPe Domain Sequences for d1pixb2:

Sequence; same for both SEQRES and ATOM records:

>d1pixb2 c.14.1.4 (B:1-287) Glutaconyl-CoA decarboxylase A subunit, N-terminal domain {Acidaminococcus fermentans [TaxId: 905]}
gfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrgel
talqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklagaw
vpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnqlg
ipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneiad
mvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpk

Timeline for d1pixb2:

• d1pixb2 first appeared in SCOP 1.73
  
• d1pixb2 appears in SCOPe 2.07