Lineage for d1pixa2 (1pix A:1-287)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690933Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 690980Protein Glutaconyl-CoA decarboxylase A subunit [102210] (1 species)
  7. 690981Species Acidaminococcus fermentans [TaxId:905] [102211] (1 PDB entry)
  8. 690982Domain d1pixa2: 1pix A:1-287 [118578]

Details for d1pixa2

PDB Entry: 1pix (more details), 2.2 Å

PDB Description: Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme A decarboxylase
PDB Compounds: (A:) Glutaconyl-CoA decarboxylase A subunit

SCOP Domain Sequences for d1pixa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]}
gfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrgel
talqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklagaw
vpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnqlg
ipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneiad
mvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpk

SCOP Domain Coordinates for d1pixa2:

Click to download the PDB-style file with coordinates for d1pixa2.
(The format of our PDB-style files is described here.)

Timeline for d1pixa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pixa3