Lineage for d1opff_ (1opf F:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886253Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 886254Protein Porin [56937] (5 species)
  7. 886259Species Escherichia coli, different sequences [TaxId:562] [56938] (15 PDB entries)
  8. 886277Domain d1opff_: 1opf F: [118577]
    duplicate of 1OPF

Details for d1opff_

PDB Entry: 1opf (more details), 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form
PDB Compounds: (F:) matrix porin outer membrane protein f

SCOP Domain Sequences for d1opff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opff_ f.4.3.1 (F:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOP Domain Coordinates for d1opff_:

Click to download the PDB-style file with coordinates for d1opff_.
(The format of our PDB-style files is described here.)

Timeline for d1opff_: