Lineage for d1opfe_ (1opf E:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627628Protein Porin [56937] (5 species)
  7. 2627631Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries)
  8. 2627678Domain d1opfe_: 1opf E: [118576]
    duplicate of 1OPF

Details for d1opfe_

PDB Entry: 1opf (more details), 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form
PDB Compounds: (E:) matrix porin outer membrane protein f

SCOPe Domain Sequences for d1opfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opfe_ f.4.3.1 (E:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOPe Domain Coordinates for d1opfe_:

Click to download the PDB-style file with coordinates for d1opfe_.
(The format of our PDB-style files is described here.)

Timeline for d1opfe_: