SCOPe 2.07: Domain d1opfc_: 1opf C:

Lineage for d1opfc_ (1opf C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries)

8. Domain d1opfc_: 1opf C: [118574]
   duplicate of 1OPF

Details for d1opfc_

PDB Entry: 1opf, 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form

PDB Compounds: (C:) matrix porin outer membrane protein f

SCOPe Domain Sequences for d1opfc_:

Sequence; same for both SEQRES and ATOM records:

>d1opfc_ f.4.3.1 (C:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d1opfc_:

• d1opfc_ first appeared in SCOP 1.73
  
• d1opfc_ appears in SCOPe 2.06
  
• d1opfc_ appears in the current release, SCOPe 2.08