Lineage for d1o8cd3 (1o8c D:2-115,D:293-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785780Protein Hypothetical protein YhdH [101706] (1 species)
  7. 2785781Species Escherichia coli [TaxId:562] [101707] (2 PDB entries)
    Uniprot P26646
  8. 2785786Domain d1o8cd3: 1o8c D:2-115,D:293-323 [118572]
    Other proteins in same PDB: d1o8ca4, d1o8ca5, d1o8cb4, d1o8cb5, d1o8cc3, d1o8cd4, d1o8cd5
    Structural genomics target
    complexed with ndp

Details for d1o8cd3

PDB Entry: 1o8c (more details), 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph
PDB Compounds: (D:) yhdh

SCOPe Domain Sequences for d1o8cd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8cd3 b.35.1.2 (D:2-115,D:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}
qallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmip
gidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgXqaake
islseapnfaeaiinnqiqgrtlvkv

SCOPe Domain Coordinates for d1o8cd3:

Click to download the PDB-style file with coordinates for d1o8cd3.
(The format of our PDB-style files is described here.)

Timeline for d1o8cd3: