![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Hypothetical protein YhdH [101706] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101707] (2 PDB entries) Uniprot P26646 |
![]() | Domain d1o8ca3: 1o8c A:2-115,A:293-323 [118570] Other proteins in same PDB: d1o8ca4, d1o8ca5, d1o8cb4, d1o8cb5, d1o8cc3, d1o8cd4, d1o8cd5 Structural genomics target complexed with ndp |
PDB Entry: 1o8c (more details), 2.6 Å
SCOPe Domain Sequences for d1o8ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8ca3 b.35.1.2 (A:2-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} qallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmip gidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgXqaake islseapnfaeaiinnqiqgrtlvkv
Timeline for d1o8ca3: