Lineage for d1mlij_ (1mli J:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723748Family d.58.4.1: Muconalactone isomerase, MLI [54910] (1 protein)
    decamer: pentamer of dimers
  6. 723749Protein Muconalactone isomerase, MLI [54911] (1 species)
  7. 723750Species Pseudomonas putida [TaxId:303] [54912] (1 PDB entry)
  8. 723760Domain d1mlij_: 1mli J: [118563]
    duplicate of 1MLI

Details for d1mlij_

PDB Entry: 1mli (more details), 3.3 Å

PDB Description: crystal structure of muconolactone isomerase at 3.3 angstroms resolution
PDB Compounds: (J:) muconolactone isomerase

SCOP Domain Sequences for d1mlij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlij_ d.58.4.1 (J:) Muconalactone isomerase, MLI {Pseudomonas putida [TaxId: 303]}
mlfhvkmtvklpvdmdpakatqlkadekelaqrlqregtwrhlwriaghyanysvfdvps
vealhdtlmqlplfpymdievdglcrhpssihsddr

SCOP Domain Coordinates for d1mlij_:

Click to download the PDB-style file with coordinates for d1mlij_.
(The format of our PDB-style files is described here.)

Timeline for d1mlij_: