Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.2: Maltoporin-like [56942] (2 proteins) trimer, one subunit folds into (18,22) barrel automatically mapped to Pfam PF02264 |
Protein Maltoporin (also LamB protein) [56943] (2 species) |
Species Escherichia coli [TaxId:562] [56944] (6 PDB entries) |
Domain d1malc_: 1mal C: [118554] duplicate of 1MAL |
PDB Entry: 1mal (more details), 3.1 Å
SCOPe Domain Sequences for d1malc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1malc_ f.4.3.2 (C:) Maltoporin (also LamB protein) {Escherichia coli [TaxId: 562]} vdfhgyarsgigwtgsggeqqcfqttgaqskyrlgnecetyaelklgqevwkegdksfyf dtnvaysvaqqndweatdpafreanvqgknliewlpgstiwagkrfyqrhdvhmidfyyw disgpgaglenidvgfgklslaatrsseaggsssfasnniydytnetandvfdvrlaqme inpggtlelgvdygranlrdnyrlvdgaskdgwlftaehtqsvlkgfnkfvvqyatdsmt sqgkglsqgsgvafdnekfayninnnghmlrildhgaismgdnwdmmyvgmyqdinwdnd ngtkwwtvgirpmykwtpimstvmeigydnvesqrtgdknnqykitlaqqwqagdsiwsr pairvfatyakwdekwgydytgnadnnanfgkavpadfnggsfgrgdsdewtfgaqmeiw w
Timeline for d1malc_: