SCOP 1.75: Domain d1lrpc_: 1lrp C:

Lineage for d1lrpc_ (1lrp C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)

8. Domain d1lrpc_: 1lrp C: [118552]
   duplicate of 1LRP

Details for d1lrpc_

PDB Entry: 1lrp, 3.2 Å

PDB Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda

PDB Compounds: (C:) lambda repressor

SCOP Domain Sequences for d1lrpc_:

Sequence; same for both SEQRES and ATOM records:

>d1lrpc_ a.35.1.2 (C:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

Timeline for d1lrpc_:

• d1lrpc_ first appeared in SCOP 1.73
  
• d1lrpc_ appears in SCOPe 2.01
  
• d1lrpc_ appears in the current release, SCOPe 2.08