SCOP 1.73: Domain d1lgrf1: 1lgr F:1-100

Lineage for d1lgrf1 (1lgr F:1-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1lgrf1: 1lgr F:1-100 [118537]
   Other proteins in same PDB: d1lgra2, d1lgrb2, d1lgrc2, d1lgrd2, d1lgre2, d1lgrf2, d1lgrg2, d1lgrh2, d1lgri2, d1lgrj2, d1lgrk2, d1lgrl2
   duplicate of 1LGR 1-100
   complexed with amp, mn

Details for d1lgrf1

PDB Entry: 1lgr, 2.8 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium

PDB Compounds: (F:) glutamine synthetase

SCOP Domain Sequences for d1lgrf1:

Sequence, based on SEQRES records:

>d1lgrf1 d.15.9.1 (F:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records):

>d1lgrf1 d.15.9.1 (F:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

Timeline for d1lgrf1:

• d1lgrf1 is new in SCOP 1.73
  
• d1lgrf1 appears in SCOP 1.75
  
• d1lgrf1 appears in the current release, SCOPe 2.08