Lineage for d1lgrc2 (1lgr C:101-468)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214219Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 2214220Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 2214270Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 2214297Domain d1lgrc2: 1lgr C:101-468 [118532]
    Other proteins in same PDB: d1lgra1, d1lgrb1, d1lgrc1, d1lgrd1, d1lgre1, d1lgrf1, d1lgrg1, d1lgrh1, d1lgri1, d1lgrj1, d1lgrk1, d1lgrl1
    duplicate of 1LGR 101-468
    complexed with amp, mn

Details for d1lgrc2

PDB Entry: 1lgr (more details), 2.79 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d1lgrc2:

Sequence, based on SEQRES records: (download)

>d1lgrc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Sequence, based on observed residues (ATOM records): (download)

>d1lgrc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvppvmlaysarnrsasir
ipvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdipqvagsleea
lnaldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv

SCOPe Domain Coordinates for d1lgrc2:

Click to download the PDB-style file with coordinates for d1lgrc2.
(The format of our PDB-style files is described here.)

Timeline for d1lgrc2: