![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
![]() | Protein Lactate dehydrogenase [51859] (14 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries) |
![]() | Domain d1ldbc1: 1ldb C:15-162 [118525] Other proteins in same PDB: d1ldba2, d1ldbb2, d1ldbc2, d1ldbd2 duplicate of 1LDB 15-162 complexed with so4 |
PDB Entry: 1ldb (more details), 2.8 Å
SCOP Domain Sequences for d1ldbc1:
Sequence, based on SEQRES records: (download)
>d1ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl vatnpvdiltyatwkfsglphervigsg
>d1ldbc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt yatwkfsglphervigsg
Timeline for d1ldbc1: