Lineage for d1ldbb1 (1ldb B:15-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105595Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 2105609Domain d1ldbb1: 1ldb B:15-162 [118523]
    Other proteins in same PDB: d1ldba2, d1ldbb2, d1ldbc2, d1ldbd2
    duplicate of 1LDB 15-162
    complexed with so4

Details for d1ldbb1

PDB Entry: 1ldb (more details), 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (B:) apo-l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldbb1:

Sequence, based on SEQRES records: (download)

>d1ldbb1 c.2.1.5 (B:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records): (download)

>d1ldbb1 c.2.1.5 (B:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

SCOPe Domain Coordinates for d1ldbb1:

Click to download the PDB-style file with coordinates for d1ldbb1.
(The format of our PDB-style files is described here.)

Timeline for d1ldbb1: