Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
Protein Triacylglycerol lipase [53559] (7 species) |
Species Yeast (Candida antarctica), form b [TaxId:34362] [53560] (6 PDB entries) |
Domain d1lbsf_: 1lbs F: [118521] duplicate of 1LBS complexed with hee |
PDB Entry: 1lbs (more details), 2.6 Å
SCOPe Domain Sequences for d1lbsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbsf_ c.69.1.17 (F:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy arpfavgkrtcsgivtp
Timeline for d1lbsf_: