Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.17: Fungal lipases [53558] (4 proteins) |
Protein Triacylglycerol lipase [53559] (6 species) |
Species Yeast (Candida antarctica), form b [TaxId:34362] [53560] (5 PDB entries) |
Domain d1lbse_: 1lbs E: [118520] duplicate of 1LBS complexed with hee, nag |
PDB Entry: 1lbs (more details), 2.6 Å
SCOP Domain Sequences for d1lbse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbse_ c.69.1.17 (E:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy arpfavgkrtcsgivtp
Timeline for d1lbse_: