Lineage for d1iveb_ (1ive B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807621Protein Influenza neuraminidase [50943] (9 species)
  7. 2807670Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. 2807773Domain d1iveb_: 1ive B: [118514]
    duplicate of 1IVE
    complexed with ca, st3

Details for d1iveb_

PDB Entry: 1ive (more details), 2.4 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (B:) influenza a subtype n2 neuraminidase

SCOPe Domain Sequences for d1iveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iveb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d1iveb_:

Click to download the PDB-style file with coordinates for d1iveb_.
(The format of our PDB-style files is described here.)

Timeline for d1iveb_: